DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42296 and CG13837

DIOPT Version :10

Sequence 1:NP_652638.2 Gene:CG42296 / 53544 FlyBaseID:FBgn0259192 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster


Alignment Length:133 Identity:29/133 - (21%)
Similarity:49/133 - (36%) Gaps:33/133 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   713 TSSPNLNPFKGGNVKYPGSTS----------PNG-----QLVNFNGNFISLDVFQKSILPLMTKS 762
            |.||::       ||.|...:          ||.     .:|.:.|..::     |:..|....|
  Fly    89 TKSPSM-------VKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLA-----KACTPAHLVS 141

  Fly   763 PSALNELGNVEVITCQAGVR--QPNQTDCTRYFVCSKKDGKVLSYSCPPYTAFNKQTRICDAPTY 825
            .:.:....|  :|.||.||.  .|:..:|..::.||  .|..|.:.|.....::.:.|.|...:.
  Fly   142 CNRMQTREN--IINCQEGVYGFMPHPRNCAYFYYCS--SGSKLVHRCHLNYTWHYERRSCVQQSE 202

  Fly   826 AQC 828
            ..|
  Fly   203 RMC 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42296NP_652638.2 ChtBD2 21..70 CDD:214696
CBM_14 784..828 CDD:426342 9/43 (21%)
CG13837NP_651113.1 CBM_14 36..81 CDD:426342
CBM_14 154..203 CDD:426342 13/50 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.