DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42296 and CG6933

DIOPT Version :10

Sequence 1:NP_652638.2 Gene:CG42296 / 53544 FlyBaseID:FBgn0259192 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_730495.1 Gene:CG6933 / 40214 FlyBaseID:FBgn0036952 Length:363 Species:Drosophila melanogaster


Alignment Length:80 Identity:15/80 - (18%)
Similarity:34/80 - (42%) Gaps:22/80 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LESYVRMFGDLNESELIKPENLKHLLRTCYNLAMAHYS-DGPQSCRLLNRTLDSVVQSCFFSKES 161
            :||:|.:.|             |:|::..:.|....|: |..:...:|::.:....:|....|:.
  Fly     3 IESHVSVPG-------------KNLVKVEFKLGTESYTIDSIKGDTVLDQLVSMKEESMKILKDF 54

  Fly   162 LSPGYICRWLENNVP 176
            ::        ::|||
  Fly    55 IT--------KHNVP 61

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42296NP_652638.2 ChtBD2 21..70 CDD:214696
CBM_14 784..828 CDD:426342
CG6933NP_730495.1 ChtBD2 44..90 CDD:214696 5/26 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.