DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42296 and CG5883

DIOPT Version :10

Sequence 1:NP_652638.2 Gene:CG42296 / 53544 FlyBaseID:FBgn0259192 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_648526.2 Gene:CG5883 / 39352 FlyBaseID:FBgn0036225 Length:339 Species:Drosophila melanogaster


Alignment Length:92 Identity:21/92 - (22%)
Similarity:33/92 - (35%) Gaps:28/92 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GLFY-------------FSEGKPCPEKTRPHK------------TRCDAFYKCRELPSNSHVWIP 51
            ||:|             ..|..|.|::...:|            ..|..:|.||:|.|......|
  Fly   188 GLYYNVATGTCVRKKDVICENHPLPDEVCGNKKLAVRNKFVSDMATCRGYYYCRDLGSGIPDTDP 252

  Fly    52 V--KCNEGLVFESSLGSCVLPGEDWEC 76
            :  :|:|...|.....:| :|.|..:|
  Fly   253 IYQQCDENNFFNQERQAC-MPRESQKC 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42296NP_652638.2 ChtBD2 21..70 CDD:214696 14/62 (23%)
CBM_14 784..828 CDD:426342
CG5883NP_648526.2 CBM_14 95..146 CDD:426342
CBM_14 154..204 CDD:426342 3/15 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.