DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42296 and CG32302

DIOPT Version :10

Sequence 1:NP_652638.2 Gene:CG42296 / 53544 FlyBaseID:FBgn0259192 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_728732.1 Gene:CG32302 / 38293 FlyBaseID:FBgn0052302 Length:313 Species:Drosophila melanogaster


Alignment Length:263 Identity:55/263 - (20%)
Similarity:79/263 - (30%) Gaps:116/263 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   656 YSSD--------MSQQLAPSNGYLEQSYSLQQPQHHHHPY------------MPRPRPTMSSSIY 700
            |.||        .||...|..|    .:|.||......||            :..||...:.:.|
  Fly    68 YCSDEGTFGCTFQSQCQVPKRG----PFSCQQAGLFPDPYDCRRYHECSDQSVDTPRICSNGAGY 128

  Fly   701 SDSDGNMEM---------SMFTSSPNLNPFKGGNVKYPGSTSPNGQLVNFNGNFISLDVFQKSIL 756
            |...|...:         ..||.|      :.|.|   |..:|:.:..     ::.::....|:.
  Fly   129 STLTGTCVLPRESEQCIQEQFTCS------RSGQV---GGWAPDNRYF-----YVCVNDTANSLY 179

  Fly   757 PLMTK-------------------------------------SPSALNEL-------GNVEVITC 777
            |||.|                                     .|...:|:       |.:||:||
  Fly   180 PLMMKCHEGFVFNSYSCVPDTRSMRSIQAMESHTCMNNDRYQCPFRTSEIEYCKCVDGELEVMTC 244

  Fly   778 QAGVR-QPNQTDCT--RYFVCSKKDGKVLS--------------------YSCPPYTAFNKQTRI 819
            .||.: .|....|.  |.:.||  |.::||                    ||||....||.:||.
  Fly   245 PAGFQIDPKILTCVTDRIYQCS--DFEILSCPNVSTKDEYCICIDHQLQIYSCPMGQYFNAETRK 307

  Fly   820 CDA 822
            |.:
  Fly   308 CQS 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42296NP_652638.2 ChtBD2 21..70 CDD:214696
CBM_14 784..828 CDD:426342 17/61 (28%)
CG32302NP_728732.1 CBM_14 94..144 CDD:426342 9/49 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.