DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG42296 and CG34324

DIOPT Version :10

Sequence 1:NP_652638.2 Gene:CG42296 / 53544 FlyBaseID:FBgn0259192 Length:994 Species:Drosophila melanogaster
Sequence 2:NP_001096972.1 Gene:CG34324 / 32302 FlyBaseID:FBgn0085353 Length:267 Species:Drosophila melanogaster


Alignment Length:115 Identity:28/115 - (24%)
Similarity:44/115 - (38%) Gaps:30/115 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   715 SPNLNPFKGGNVKYPGSTSPNGQLVNFNGNFISLDVFQKSILPLMTKSPSALNELGNVEVITCQA 779
            |.|..|...||.:.|...:|             :.:.|    .|:::......|.|     |..|
  Fly   177 SDNAGPIVDGNEEQPDIDNP-------------VAIAQ----VLISRHDCRGQEDG-----TFLA 219

  Fly   780 GVRQPNQTDCTRYFVCSKKDGKVLSYSCPPYTAFNKQTRICD-APTYAQC 828
            .||.     |.||:||:::..|  ..:||....|:::.:.|. |.|...|
  Fly   220 DVRH-----CRRYYVCNRQRSK--RQNCPNGYWFDRELKACRLASTVNNC 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG42296NP_652638.2 ChtBD2 21..70 CDD:214696
CBM_14 784..828 CDD:426342 12/44 (27%)
CG34324NP_001096972.1 CBM_14 209..262 CDD:426342 18/64 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.