DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CLEC6A

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001007034.1 Gene:CLEC6A / 93978 HGNCID:14556 Length:209 Species:Homo sapiens


Alignment Length:133 Identity:37/133 - (27%)
Similarity:64/133 - (48%) Gaps:21/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 AQMDGYFSAI----NGVQ-----CLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIK 198
            :::..|.|::    .|.:     |....::..|...::|..: |..|..::..|..||.||....
Human    55 SELHSYHSSLTCFSEGTKVPAWGCCPASWKSFGSSCYFISSE-EKVWSKSEQNCVEMGAHLVVFN 118

  Fly   199 TKQEFDAIVEKLDDSKSYFLGV-----NENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCV 258
            |:.|.:.||::|::|.|||||:     |.|.:..|  .....|:..:  |..|||:|:  .|:|.
Human   119 TEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQWID--KTPYEKNVRF--WHLGEPNHS--AEQCA 177

  Fly   259 SIL 261
            ||:
Human   178 SIV 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 32/98 (33%)
CLEC6ANP_001007034.1 CLECT_DC-SIGN_like 79..204 CDD:153060 33/109 (30%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000269|PubMed:28652405, ECO:0007744|PDB:5VYB 168..170 1/1 (100%)
Alpha-D-mannopyranose binding. /evidence=ECO:0000269|PubMed:28652405, ECO:0007744|PDB:5VYB 190..191
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.