DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Clec4g

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_083741.1 Gene:Clec4g / 75863 MGIID:1923113 Length:294 Species:Mus musculus


Alignment Length:311 Identity:67/311 - (21%)
Similarity:115/311 - (36%) Gaps:86/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RLSVLVLNL--------LLVSHEFSAGTAKIEIQPLPALCNGYCFPTLKPVMEYVAIHQDKWNTC 59
            ||..|||.|        |::|...|:.::|:.:                     :..|||     
Mouse    30 RLFFLVLALLVATVLWALILSTLLSSASSKLRV---------------------LLSHQD----- 68

  Fly    60 TEILANEARKDQIQLNIQLDALKADVS------NIKASQLS------KDEKLDRMEREQFAMHES 112
              :|...|.:.::.|:    :||.|:.      ::..:||.      ||.:...||:|..     
Mouse    69 --LLRTNASEQKMTLS----SLKDDIGACRNCCSVTKAQLQTTLAEFKDIQAKLMEQESI----- 122

  Fly   113 LETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGV--------QCLQPGFEKIGDRY 169
            |:.:...:|..|.:.....|.|::.:          |.|:..|        ||........|..|
Mouse   123 LKELQERVTQDLAKASRDRENIRSEL----------FQALEAVKRQNSSCEQCPPSWLPFQGSCY 177

  Fly   170 FYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNE----NTKTGDFV 230
            ::.|  .:..|..||:.|...|.||..::...| ...:.:....:.|:||:..    |...|  .
Mouse   178 YFSE--TQATWDTAQSYCGGQGAHLVIVRGLNE-QGFLSQHTRGRGYWLGLRAVRHLNKIQG--Y 237

  Fly   231 SAASGKSCLYHEWGPGEPHHNNDQERCVSILRK-LMHVGNCTYEK-RFICQ 279
            ....|.|..:..|..|||:.:...|.|:.:|.. |.:...||.|: .:||:
Mouse   238 RWVDGASLNFSHWNSGEPNDSRGHEDCIMMLHSGLWNDAPCTNERDGWICE 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 30/117 (26%)
Clec4gNP_083741.1 COG6 61..>163 CDD:303003 24/148 (16%)
CLECT 165..289 CDD:295302 32/129 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.