DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and lectin-22C

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001137766.1 Gene:lectin-22C / 7354375 FlyBaseID:FBgn0259230 Length:263 Species:Drosophila melanogaster


Alignment Length:277 Identity:87/277 - (31%)
Similarity:130/277 - (46%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLVLNLLLVSHEFSAGTAKIEIQPL---PALCNGYCFPTLKPVMEYVAIHQDKWNTCTEILANEA 67
            :|.|||      :.|......|.||   |:.|.|:|...|.||:.::.|.|:..|:.....|||.
  Fly    12 LLALNL------YGAWAESDVICPLKDPPSQCGGFCLGVLTPVLNHLTISQNLANSNNSSKANEV 70

  Fly    68 RKDQIQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLE 132
            ...|..:..||.||:....:|:.:..::..||: :..:.|.  |.|..:...|:. |::|.|:  
  Fly    71 LVRQYTMEGQLTALQNKQLSIEVALDAQGRKLN-VNEQNFT--ERLNCMEGILSA-LEKTVLE-- 129

  Fly   133 AIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASI 197
             :|..:.|:                   |||:||.:|:|||:..|.||..|...||.||||||.|
  Fly   130 -VKTKIKYL-------------------GFEQIGSKYYYIEKVSEKNWSTASKTCRNMGGHLADI 174

  Fly   198 KTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILR 262
            |.:.:..||...|.:...|:||:|:....|.|:|..:||...:.:|..|.| ...|...||.:..
  Fly   175 KDEADLAAIKANLKEDTHYWLGINDLDHEGKFLSMPTGKQTTFLKWASGRP-SQLDTLNCVFLYN 238

  Fly   263 KLMHVGNCTYEKRFICQ 279
            ..|:...|.|..|||||
  Fly   239 GEMYDYPCHYTFRFICQ 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 44/111 (40%)
lectin-22CNP_001137766.1 CLECT 146..255 CDD:153057 42/109 (39%)

Return to query results.
Submit another query.