DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Mbl2

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_073195.2 Gene:Mbl2 / 64668 RGDID:67380 Length:244 Species:Rattus norvegicus


Alignment Length:144 Identity:37/144 - (25%)
Similarity:63/144 - (43%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 TVKLDRTKLQLE--AIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIE-EDVELNWLD 182
            :|:.|.|.:.||  |:::.:..|:..:            |....|.:|.:||... ..:.||  .
  Rat    96 SVEFDTTNIDLEIAALRSELRAMRKWV------------LLSMSENVGKKYFMSSVRRMPLN--R 146

  Fly   183 AQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGE 247
            |:|.|..:.|.:|:.:..:|..||.....|..  |||:.:. :|.:.....:|....|..|..||
  Rat   147 AKALCSELQGTVATPRNAEENRAIQNVAKDVA--FLGITDQ-RTENVFEDLTGNRVRYTNWNEGE 208

  Fly   248 PHHNNDQERCVSIL 261
            |::....|.||.:|
  Rat   209 PNNVGSGENCVVLL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 27/94 (29%)
Mbl2NP_073195.2 Collagen 36..95 CDD:460189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..99 1/2 (50%)
CLECT_collectin_like 132..242 CDD:153061 27/96 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.