DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Clec10a

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_008766090.1 Gene:Clec10a / 64195 RGDID:621158 Length:307 Species:Rattus norvegicus


Alignment Length:240 Identity:47/240 - (19%)
Similarity:92/240 - (38%) Gaps:37/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 NTCTEILANEARKDQIQLNIQLDALKADVSN----IKASQLSKDEKLDRMEREQFAMHESLETIN 117
            ||..|:.|..:|.|.:|..|  ::||.:|.:    ::|.: ...:|:..:|.   .:.:..:|:.
  Rat    81 NTKAELQALASRGDSLQTGI--NSLKVEVDDHGQELQAGR-GLSQKVASLES---TVEKKEQTLR 139

  Fly   118 RYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLD 182
            ..|:...||.: ||.....|:....|.:....||:  ..|.....|..|..|::.:....  |.:
  Rat   140 TDLSEITDRVQ-QLGKDLKTLTCQLASLKNNGSAV--ACCPLHWMEHEGSCYWFSQSGKP--WPE 199

  Fly   183 AQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGE 247
            |...|:....:|.::.:..|.:.:...: .|...::|:.:......:|.....:....| |.|.:
  Rat   200 ADKYCQLENSNLVAVNSLAEQNFLQTHM-GSVVTWIGLTDQNGPWRWVDGTDYEKGFTH-WAPKQ 262

  Fly   248 P-----HHNNDQERCVSILRKLMHVGN--------CTYEKRFICQ 279
            |     |.....|.|.       |..:        |....|::|:
  Rat   263 PDNWYGHGLGGGEDCA-------HFTSDGRWNDDVCQRPYRWVCE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 20/124 (16%)
Clec10aXP_008766090.1 Lectin_N 21..166 CDD:281887 22/91 (24%)
Apolipoprotein <63..166 CDD:279749 22/91 (24%)
CLECT_DC-SIGN_like 176..301 CDD:153060 23/136 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.