DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and clec11a

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_696773.2 Gene:clec11a / 568355 ZFINID:ZDB-GENE-130530-861 Length:273 Species:Danio rerio


Alignment Length:294 Identity:60/294 - (20%)
Similarity:116/294 - (39%) Gaps:87/294 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SHEFSAGTAK--------IEIQPLPALCNGYCFPTLKPVMEYVAIHQDKWNTCTEILANEARKDQ 71
            :.||:.|..:        :|.:|..|:                   .|..:|...||:..|..||
Zfish    41 AREFNEGIVRGRGDTPDILEPEPTTAV-------------------SDMESTYNYILSRLAAMDQ 86

  Fly    72 I--QLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKL-QLEA 133
            .  :||:....|     :||.:||.  ||:.|::.......::::.::.|  .|.:|.:: :||.
Zfish    87 AIHRLNVGQYTL-----DIKVTQLL--EKVSRLDNRLGDTEDAIQQVSSY--CKDNRKEIGRLEG 142

  Fly   134 IKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIK 198
            .:      |.:..||       :|:             :...|...:.||..||:..||.:|..:
Zfish   143 CQ------KGRKIGY-------KCV-------------LAYRVYETYADASKKCQERGGRMAMPR 181

  Fly   199 TKQEFDAIVEKLDDSKSYF-------LGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQ-- 254
            .::|.:|:.|.:   ||.|       ||:|:....|.::...:.: ..|.:|   ..|..:.|  
Zfish   182 DRKEQEALAEYV---KSVFHGNWPVWLGINDERSEGLYLFEDTTR-VTYFQW---RKHFLSSQPD 239

  Fly   255 ----ERCVSILRKLMHVGNCTYEKR--FICQYGI 282
                |.||::........:...|:|  ::|::.:
Zfish   240 GGKRENCVAMSSDDGDWWDTYCERRMYYLCEFDV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 28/125 (22%)
clec11aXP_696773.2 CLECT 143..271 CDD:295302 32/160 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.