DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and si:dkey-241l7.3

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_068071822.1 Gene:si:dkey-241l7.3 / 567766 ZFINID:ZDB-GENE-041014-239 Length:157 Species:Danio rerio


Alignment Length:107 Identity:29/107 - (27%)
Similarity:54/107 - (50%) Gaps:7/107 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VQCLQPGFEKIGDRYF-YIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFL 218
            ::| :.|:...|.|.| :....|  ||:.|:..|:.:||:|||:..:.|.|.::..:..|...::
Zfish    29 LRC-ERGWSGSGSRCFRFFSRSV--NWVTAERNCQSLGGNLASVHDQVENDFLLTLVPGSTRCWI 90

  Fly   219 GVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSI 260
            |.::..:.|.:: .:.|....|..|..|||  :...|.|:.|
Zfish    91 GGHDGEQDGQWL-WSDGSVYGYTNWCSGEP--SGGSEHCLEI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 25/93 (27%)
si:dkey-241l7.3XP_068071822.1 CLECT 31..150 CDD:214480 29/105 (28%)

Return to query results.
Submit another query.