DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and hbl2

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_009296949.2 Gene:hbl2 / 566971 ZFINID:ZDB-GENE-070912-286 Length:253 Species:Danio rerio


Alignment Length:155 Identity:43/155 - (27%)
Similarity:69/155 - (44%) Gaps:14/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 LEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLA 195
            :|::|:.:..:||::|....|.:     ...|.::|.:| |:.:.:..|:.|....|:..||.|.
Zfish   104 IESLKSEIQNLKAEIDTIEKAAS-----FSNFRRVGQKY-YVTDGILGNFNDGIKFCKDAGGTLV 162

  Fly   196 SIKTKQEFDAIV-----EKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQE 255
            ..||..|..|:|     ..|...|.| :||.:....|.||. ..||...:..||||:|......:
Zfish   163 VPKTAAENQALVRVSVSSALSTGKPY-IGVTDRETEGQFVD-IEGKQLTFTNWGPGQPDDYRGGQ 225

  Fly   256 RC-VSILRKLMHVGNCTYEKRFICQ 279
            .| |..:......|||...:..||:
Zfish   226 DCGVIEVSGTWDDGNCGDIRPIICE 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 35/117 (30%)
hbl2XP_009296949.2 Collagen <36..70 CDD:189968
CLECT_collectin_like 135..251 CDD:153061 35/119 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10963
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.