DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and zgc:174904

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001170922.1 Gene:zgc:174904 / 564690 ZFINID:ZDB-GENE-080204-76 Length:320 Species:Danio rerio


Alignment Length:293 Identity:60/293 - (20%)
Similarity:115/293 - (39%) Gaps:72/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ALCNGYCFPTLKPVMEYVAIHQDKWNTCTEILANEARKDQIQL-NIQLDALKADVSNIK--ASQL 93
            |....:|. .|..|:....:|..|.::..:..::.|.....|. :|.:.||..::...|  .|:|
Zfish    50 ACLTAFCL-ILLLVLVVTGLHAGKTSSSGQGSSSSAAAAHQQTGSINVTALTTELQTAKREKSEL 113

  Fly    94 SKDE-KLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQC 157
            .||: :|::.:||                  |::.|.:||..|:.::..|::::...|.      
Zfish   114 EKDKSELEKKKRE------------------LEKEKSELEKKKSELEKRKSELEKEKSE------ 154

  Fly   158 LQPGFEKIGD--------------------------RYF----YIEEDVELNWLDAQAKCRRMGG 192
            ||....::.|                          ::|    |.......:|.|:|..|:|.||
Zfish   155 LQKELLQLKDKVTKCEVTPAPRTTPAPTTSPCPQNWKHFNGSCYFISVTTRSWTDSQTYCKRYGG 219

  Fly   193 HLASIKTKQEFDAIVEKLDDS--KSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQE 255
            |||.|.|.:|...|.:.|...  .:::.|:::. |..|......|...:...|..|||:::.|::
Zfish   220 HLAIILTAEEQTFIWDLLPRGYWNAFWFGISDE-KVEDDWHWVDGTKLVGGFWEDGEPNNHIDED 283

  Fly   256 RCVSILR---------KLMHVGNCTYEKRFICQ 279
             |..:::         |..:...|.....:||:
Zfish   284 -CGYMIKTDVLTRVAIKSWYDAPCHMSLPWICE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 31/126 (25%)
zgc:174904NP_001170922.1 CLECT_DC-SIGN_like 186..316 CDD:153060 31/132 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ6D
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.