DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and illr4

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001035129.1 Gene:illr4 / 559737 ZFINID:ZDB-GENE-050311-5 Length:259 Species:Danio rerio


Alignment Length:252 Identity:47/252 - (18%)
Similarity:93/252 - (36%) Gaps:52/252 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLT----------VKLD-------- 125
            |.:.::|..:|..|..||::.|..:.:........:.:...||          :.|.        
Zfish     4 DVVYSEVVFVKKKQADKDDEDDPDQCDLQKRRSCCDGVRLVLTALCVIFTTGLIALSFLCYMQAT 68

  Fly   126 ---RTKLQLEAIKNTMDYMKAQMDGYFSAI----------------NGVQCLQPGFEKIGDRYFY 171
               ..:.:|:.::...|.::..... |||:                |..||.:......|..|::
Zfish    69 SNHNFQKKLQDLQEVHDALQENFTA-FSAVLEHIYNREQNLSRALNNSAQCPEDWQYHAGKCYYF 132

  Fly   172 IEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSK-SYFLGVNENTKTGDFVSAASG 235
            ......|:|..::..|...||||..|..:.|.:.::.|.:..| |:::|:.:.:..|.::...:.
Zfish   133 SSNTNTLDWFKSRDACISDGGHLVIINNRDEQEFLMSKTNKYKGSFWIGLTDKSTEGQWLWVDNT 197

  Fly   236 K-SCLYHEWGPGEP-------HHNNDQERCVSILRKLMHVGN-----CTYEKRFICQ 279
            | |.....|...||       :...:.|.|..|.:...::.:     ||...|.||:
Zfish   198 KLSTDIRYWNGQEPDNWKGYRNEYTEGEDCARIEQNNWNINSWFDAFCTIAFRRICE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 28/125 (22%)
illr4NP_001035129.1 CLECT_DC-SIGN_like 118..255 CDD:153060 30/137 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.