DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and lectin-30A

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_652635.2 Gene:lectin-30A / 53541 FlyBaseID:FBgn0040097 Length:223 Species:Drosophila melanogaster


Alignment Length:261 Identity:65/261 - (24%)
Similarity:121/261 - (46%) Gaps:64/261 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 YCF---------------PTLKPVM-EYVAIHQDKWNTCTEILANEARKDQIQLNIQLDALKADV 85
            |||               .|..|:: :.|||:|.:|.|...:..:|.::..:::           
  Fly     4 YCFICVILAWASRDVLANKTENPLLIDQVAINQQQWFTFIALKESEMQQKIVRI----------- 57

  Fly    86 SNIKASQLSKDEKLDRMERE-QFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYF 149
                  :.|.:|:|..|:.: .:|::| |:||....:|:             |::.::..     
  Fly    58 ------ERSIEERLMAMQSKLAYALNE-LQTIMGNQSVE-------------TLEKLRIS----- 97

  Fly   150 SAINGVQCLQPG-FEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDS 213
                  ..:.|. |:::|.|.||||::.:.||..|...||::|||:|:|:.:|||:.|..:. .:
  Fly    98 ------HRINPALFQRMGTRRFYIEKENKQNWFGASNTCRQLGGHIATIRDEQEFNEIFSRA-PA 155

  Fly   214 KSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGNCTYEKRFIC 278
            ..:::.:|...|.|.|.|:.:|:|..:.:|...|..:..|   ||::..|.|:..||.....|||
  Fly   156 GVFWIDMNAMFKNGLFASSLTGRSPPFFKWKKEERGNKFD---CVNVYNKEMYNENCFNTHLFIC 217

  Fly   279 Q 279
            |
  Fly   218 Q 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 38/111 (34%)
lectin-30ANP_652635.2 CLECT 118..218 CDD:153057 32/103 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448764
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5252
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
87.800

Return to query results.
Submit another query.