DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CLEC4A

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_057268.1 Gene:CLEC4A / 50856 HGNCID:13257 Length:237 Species:Homo sapiens


Alignment Length:164 Identity:43/164 - (26%)
Similarity:73/164 - (44%) Gaps:23/164 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   128 KLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGG 192
            |...|.:..|::.:|..|....:|.:   |....::......::|..: ..:|.|::..|.||..
Human    79 KTTKELVHTTLECVKKNMPVEETAWS---CCPKNWKSFSSNCYFISTE-SASWQDSEKDCARMEA 139

  Fly   193 HLASIKTKQEFDAIVEKLDDSKSYFLGVN--ENTKTGDFVSAASGKSCLYHE----WGPGEPHHN 251
            ||..|.|::|.|.|.:.|.:..:||:|::  |..:...:|....     |:|    |.|.||...
Human   140 HLLVINTQEEQDFIFQNLQEESAYFVGLSDPEGQRHWQWVDQTP-----YNESSTFWHPREPSDP 199

  Fly   252 NDQERCVSI-LRKL-----MHVGNCTYEKRFICQ 279
            |  ||||.: .||.     .:..||...:|.:|:
Human   200 N--ERCVVLNFRKSPKRWGWNDVNCLGPQRSVCE 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 36/123 (29%)
CLEC4ANP_057268.1 ITIM motif. /evidence=ECO:0000269|PubMed:20530286 5..10
CLECT_DC-SIGN_like 106..232 CDD:153060 36/134 (27%)
Mannose binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 195..197 1/1 (100%)
N-acetyl-D-glucosamine binding. /evidence=ECO:0000269|PubMed:27015765, ECO:0007744|PDB:5B1X 207..209 0/1 (0%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.