DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CD207

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_056532.4 Gene:CD207 / 50489 HGNCID:17935 Length:328 Species:Homo sapiens


Alignment Length:256 Identity:60/256 - (23%)
Similarity:102/256 - (39%) Gaps:57/256 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 IQLNIQLDALKADVSNIKA--SQLSKDEKLDRME----------------REQF-AMHESLETIN 117
            ::.|:||  ||..|.||..  |::.|:.  |.||                |.|| .:..|:|..|
Human    74 VKTNVQL--LKGRVDNISTLDSEIKKNS--DGMEAAGVQIQMVNESLGYVRSQFLKLKTSVEKAN 134

  Fly   118 RYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAIN-GVQCLQPGFEKI---------------- 165
            ..:.: |.|:..::..:...:..:|:.:: ..||:| .::.||...|.:                
Human   135 AQIQI-LTRSWEEVSTLNAQIPELKSDLE-KASALNTKIRALQGSLENMSKLLKRQNDILQVVSQ 197

  Fly   166 GDRY----FYIEEDVELNWLDAQAKCRRMGGHLASI--KTKQEFDAIVEKLDDSKSYFLGVNENT 224
            |.:|    ||....:...|..|:..|.....||.|:  :::|||   :.|......|::|:.:..
Human   198 GWKYFKGNFYYFSLIPKTWYSAEQFCVSRNSHLTSVTSESEQEF---LYKTAGGLIYWIGLTKAG 259

  Fly   225 KTGDFV---SAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGN---CTYEKRFICQ 279
            ..||:.   .....|......|.||||::..:.|.|.:|....:...|   |.....|||:
Human   260 MEGDWSWVDDTPFNKVQSVRFWIPGEPNNAGNNEHCGNIKAPSLQAWNDAPCDKTFLFICK 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 31/123 (25%)
CD207NP_056532.4 CLECT_DC-SIGN_like 196..321 CDD:153060 32/128 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.