DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Cd207

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_578352.4 Gene:Cd207 / 502852 RGDID:1565913 Length:332 Species:Rattus norvegicus


Alignment Length:232 Identity:51/232 - (21%)
Similarity:91/232 - (39%) Gaps:44/232 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 TEILANEARKDQIQLNIQLDAL---KADVSNIKASQLSKD-EKLDRMEREQFAMHESLETINRYL 120
            ::||:.||....:...:|:..:   :.|..|.|..:|.|| :|...:..:...:..|||.||:.|
  Rat   125 SKILSLEASMKIVSNQLQVLTMNWGEVDNLNAKIPELQKDLDKASALNTKVQGLQNSLENINKLL 189

  Fly   121 TVKLDRTKLQLEAIKNTMDYMKAQMDG--YFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDA 183
                          |...|.::....|  ||               :|:.|::  ......|..|
  Rat   190 --------------KEQSDILEMMSRGWKYF---------------MGNFYYF--SRTPKTWYSA 223

  Fly   184 QAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFV---SAASGKSCLYHEWGP 245
            :..|.....||.|:.::.|.: .:.|:.|...:::|:.:....||:.   ..:..|......|.|
  Rat   224 EQYCISRKAHLTSVSSESEHE-FLYKVADGIPHWIGLTKAGSEGDWYWVDQTSFNKEQSRRFWIP 287

  Fly   246 GEPHHNNDQERCVSILRKLMHVGN---CTYEKRFICQ 279
            |||::..:.|.|.:|....:...|   |.....|||:
  Rat   288 GEPNNVRNNEHCANIRVSALKCWNDSPCDNVYSFICK 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 27/117 (23%)
Cd207XP_578352.4 DUF881 127..>190 CDD:303034 18/76 (24%)
CLECT_DC-SIGN_like 202..325 CDD:153060 31/141 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.