DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Cd209e

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006248837.1 Gene:Cd209e / 501797 RGDID:1563333 Length:215 Species:Rattus norvegicus


Alignment Length:227 Identity:45/227 - (19%)
Similarity:92/227 - (40%) Gaps:46/227 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LANEARKDQIQLNIQL-------DALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYL 120
            ||....:..|.|.:||       ..|.|.|  |:.|::...|::...:.:|..|::         
  Rat    16 LAGFLDRSNIPLVLQLLFLILFAGLLVAIV--IQVSKIPSSEEVQWEQTKQEKMYQ--------- 69

  Fly   121 TVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQA 185
                     .|..:|:.:|.:.......::..|| .|           ||:.:.  :.:|.::..
  Rat    70 ---------DLSQLKSEIDSLCRLCPWDWTFFNG-NC-----------YFFSKS--QRDWHNSIT 111

  Fly   186 KCRRMGGHLASIKTKQEFDAIVEKLDDSKSY-FLGVNENTKTGD--FVSAASGKSCLYHEWGPGE 247
            .|:.|...|.:||:.:| .:.:::......| ::|:::..|.|:  ::..:.....|.:.|..|:
  Rat   112 ACQEMEAQLVTIKSPEE-QSFLQQTSKKNGYTWMGLSDLNKEGEWYWLDGSPLSDSLRNYWNEGQ 175

  Fly   248 PHHNNDQERCVSILRKLMHVGNCTYEKRFICQ 279
            | :|.|.:.||.......:...|...|.:||:
  Rat   176 P-NNIDGQDCVEFRNDGWNDAKCDNWKFWICK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 25/114 (22%)
Cd209eXP_006248837.1 CLECT_DC-SIGN_like 85..207 CDD:153060 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.