DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and ASGR2

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_011522164.2 Gene:ASGR2 / 433 HGNCID:743 Length:410 Species:Homo sapiens


Alignment Length:293 Identity:60/293 - (20%)
Similarity:105/293 - (35%) Gaps:72/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QPL-PALCNGYCFPTLK---PVMEYVAIHQDKWNTCTEILANEARKDQ------IQLNIQLDALK 82
            ||| ..||:..||..|.   .::..|.|       |.....:|....|      .||..:|.:||
Human   139 QPLAQRLCSMVCFSLLALSFNILLLVVI-------CVTGSQSEGHGGQQGWARGAQLQAELRSLK 196

  Fly    83 ADVSNIKASQLSKDE------------------KLDRMEREQFAMHESLETINRYLTVKLDRTKL 129
            ...||..:|.|::.:                  ||::.:::..|.|::|....::..|.|.....
Human   197 EAFSNFSSSTLTEVQAISTHGGSVGDKITSLGAKLEKQQQDLKADHDALLFHLKHFPVDLRFVAC 261

  Fly   130 QLEAIKNTMDYMKAQMDGYFSAINGVQ---CLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMG 191
            |:|.:.:                ||.|   |.....|..|..|::......  |.:|:..|:...
Human   262 QMELLHS----------------NGSQRTCCPVNWVEHQGSCYWFSHSGKA--WAEAEKYCQLEN 308

  Fly   192 GHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEP-----HHN 251
            .||..|.:.:|...||:..:...:: :|:.::..:..:|.....:. .|..|...:|     |..
Human   309 AHLVVINSWEEQKFIVQHTNPFNTW-IGLTDSDGSWKWVDGTDYRH-NYKNWAVTQPDNWHGHEL 371

  Fly   252 NDQERCVSILRKLMHVGN-----CTYEKRFICQ 279
            ...|.||.:    ...|.     |....|::|:
Human   372 GGSEDCVEV----QPDGRWNDDFCLQVYRWVCE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 23/121 (19%)
ASGR2XP_011522164.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.