DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and MBL2

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_000233.1 Gene:MBL2 / 4153 HGNCID:6922 Length:248 Species:Homo sapiens


Alignment Length:192 Identity:37/192 - (19%)
Similarity:70/192 - (36%) Gaps:52/192 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 DEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQP 160
            |..|...||:  |:...:..|.::||..|.:                                  
Human   104 DSSLAASERK--ALQTEMARIKKWLTFSLGK---------------------------------- 132

  Fly   161 GFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTK 225
               ::|:::|....:: :.:...:|.|.:....:|:.:...|..||...:.:..  |||:.:...
Human   133 ---QVGNKFFLTNGEI-MTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEA--FLGITDEKT 191

  Fly   226 TGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGN-----CTYEKRFICQYGI 282
            .|.||. .:|....|..|..|||::....|.||.:|:.    |.     |:.....:|::.|
Human   192 EGQFVD-LTGNRLTYTNWNEGEPNNAGSDEDCVLLLKN----GQWNDVPCSTSHLAVCEFPI 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 26/115 (23%)
MBL2NP_000233.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 43..113 3/8 (38%)
CLECT_collectin_like 136..246 CDD:153061 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5300
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.