DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CLEC17A

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001191047.1 Gene:CLEC17A / 388512 HGNCID:34520 Length:378 Species:Homo sapiens


Alignment Length:233 Identity:43/233 - (18%)
Similarity:97/233 - (41%) Gaps:31/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 QDKWNTCTEILANEARKDQIQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETIN 117
            |.:|.....:|        :..::.|..|...|:.||..:|.  |:|..:..:|.....::..:.
Human   166 QKRWMVYLCLL--------VVTSLFLGCLGLTVTLIKYQELM--EELRMLSFQQMTWRTNMTGMA 220

  Fly   118 RYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLD 182
            ....:|.|..:::.:..::.:: :...:|     ...:.|.: |:.....:.:|.....: :|.:
Human   221 GLAGLKHDIARVRADTNQSLVE-LWGLLD-----CRRITCPE-GWLPFEGKCYYFSPSTK-SWDE 277

  Fly   183 AQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGE 247
            |:..|:....||..|.:..|.:.:.:.....:.|:||:|:..:.||: ....|.......|.|.|
Human   278 ARMFCQENYSHLVIINSFAEHNFVAKAHGSPRVYWLGLNDRAQEGDW-RWLDGSPVTLSFWEPEE 341

  Fly   248 PHHNNDQERCVSILRKLMHVG------NCTYEKRFICQ 279
            |::.:|:: |.:     |:.|      :|.....:||:
Human   342 PNNIHDED-CAT-----MNKGGTWNDLSCYKTTYWICE 373

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 26/117 (22%)
CLEC17ANP_001191047.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..119
CLECT_DC-SIGN_like 254..374 CDD:153060 28/129 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.