DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CLEC12B

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001123470.1 Gene:CLEC12B / 387837 HGNCID:31966 Length:276 Species:Homo sapiens


Alignment Length:241 Identity:46/241 - (19%)
Similarity:90/241 - (37%) Gaps:68/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EILANEARKDQIQLNI--QLDALKADVSNIKASQLSKDEKLDRME-------REQFAMHESLETI 116
            :|.::..:..|:|..|  |.|.|...:.|  ::.||.:|:..:.:       :||.|:       
Human    70 DINSDSEKLSQLQKTIQQQQDNLSQQLGN--SNNLSMEEEFLKSQISSVLKRQEQMAI------- 125

  Fly   117 NRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRY----FYIEEDVE 177
                       ||..|.|.:|.|:               :| .| ..|:...|    :|...:.|
Human   126 -----------KLCQELIIHTSDH---------------RC-NP-CPKMWQWYQNSCYYFTTNEE 162

  Fly   178 LNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYF-LGVNENTKTGDFVSAASGKSCLYH 241
            ..|.:::..|......|..|.:.:|.|.::.:.....|:| ||::.:         :||:|..:.
Human   163 KTWANSRKDCIDKNSTLVKIDSLEEKDFLMSQPLLMFSFFWLGLSWD---------SSGRSWFWE 218

  Fly   242 EWGPGEP--------HHNNDQERCVSILRKLMHVGNCTYEKRFICQ 279
            :.....|        ...|..:.|....:..:::..|:.|..:||:
Human   219 DGSVPSPSLFSTKELDQINGSKGCAYFQKGNIYISRCSAEIFWICE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 23/124 (19%)
CLEC12BNP_001123470.1 ITIM motif 5..10
CLECT_NK_receptors_like 143..265 CDD:153063 24/131 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.