DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CG14499

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001261072.3 Gene:CG14499 / 37086 FlyBaseID:FBgn0034317 Length:188 Species:Drosophila melanogaster


Alignment Length:118 Identity:29/118 - (24%)
Similarity:45/118 - (38%) Gaps:21/118 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 NWLDAQAKCRRMGGHLASIKTKQEFDAIVEKL----DDSKSYFLGVNENTKTGDFVSAASGKSCL 239
            |:||..  |:.:...|.|...|.||.||.|.|    ..|...:...|:...:.|:...::||...
  Fly    51 NFLDRH--CQSLNAGLLSFSNKMEFTAINEWLTTVVPQSPELWTSGNKLGGSEDYYWQSTGKKAF 113

  Fly   240 YHEWGPGEPHHNNDQERCVSILRKL-------------MHVGNCTYEKRFICQ 279
            |..|..|:|......  |:::|..:             :.|..||.....:||
  Fly   114 YLPWQAGQPTPITGD--CLTLLANVTMTAEGTTMSEHRLSVRGCTKWAPHVCQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 29/118 (25%)
CG14499NP_001261072.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.