DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Colec11

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006240022.1 Gene:Colec11 / 366588 RGDID:1309678 Length:277 Species:Rattus norvegicus


Alignment Length:158 Identity:37/158 - (23%)
Similarity:68/158 - (43%) Gaps:27/158 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHL 194
            :::.|||.:...        :|:.||:      |.....|..::|  |..:.|||..|:..||.|
  Rat   135 EIKFIKNALPSP--------AAVAGVR------ETESKIYLLVKE--EKRYADAQLSCQGRGGTL 183

  Fly   195 ASIKTKQEFDAIVEKLDDS--KSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERC 257
            :..|.:.....:...|..:  ...|:|:|:..:.|.||.:.......:::|..|||::..|:|.|
  Rat   184 SMPKDEAANGLMASYLAQAGLARVFIGINDLEREGAFVYSDRSPMQTFNKWRSGEPNNAYDEEDC 248

  Fly   258 VSILRKLMHVGN-----CTYEKRFICQY 280
            |.::..    |.     |.....|:|::
  Rat   249 VEMVAS----GGWNDVACHITMYFMCEF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 30/117 (26%)
Colec11XP_006240022.1 Collagen 40..95 CDD:189968
CLECT_collectin_like 157..272 CDD:153061 30/120 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5161
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.