DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Clec3a

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001102369.1 Gene:Clec3a / 365009 RGDID:1306295 Length:196 Species:Rattus norvegicus


Alignment Length:213 Identity:39/213 - (18%)
Similarity:78/213 - (36%) Gaps:40/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMD 139
            ::.||.:.:..|..||.:.||    .|::.:...:...:|.:.|.:....:...||...::.|..
  Rat    14 SLLLDQISSYPSRAKARKHSK----RRVKEKDGDLKSQVEKLWREVNALKEMQALQTVCLRGTKV 74

  Fly   140 YMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFD 204
            :.|.                           |:..:...::.:|...|...||.|...:...|.:
  Rat    75 HKKC---------------------------YLASEGLKHYHEANEDCISKGGTLVVPRNSDEIN 112

  Fly   205 AIVE----KLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLM 265
            |:.:    .|.....::||:|:....|.|:. ..|.:..:..|...:| ....:|.||...:...
  Rat   113 ALRDYSKRSLPGVNDFWLGINDMVTEGKFLD-VHGFAVSFLNWDRAQP-SGGKRENCVLFSQSAQ 175

  Fly   266 HVGN---CTYEKRFICQY 280
            ...:   |...||:||::
  Rat   176 GKWSDEACRSSKRYICEF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 25/117 (21%)
Clec3aNP_001102369.1 CLECT_tetranectin_like 68..193 CDD:153066 27/153 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11575
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.