DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Cd209

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001102319.1 Gene:Cd209 / 363856 RGDID:1561104 Length:237 Species:Rattus norvegicus


Alignment Length:241 Identity:47/241 - (19%)
Similarity:86/241 - (35%) Gaps:69/241 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 SQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQ----------- 144
            |..|..::||..|.|::.|..|..:|   ::.:| |||.   .||:..:|.|..           
  Rat     4 SMESNTQQLDNPEDEEYLMSGSRYSI---ISSRL-RTKF---GIKSLAEYTKQSHNPLVLPLLSF 61

  Fly   145 --MDGYFSAINGVQCLQPGFE---KI---------------------------GDRYFYIEEDVE 177
              :.|....|..:....|..|   ||                           |..||:.:.  :
  Rat    62 LFLAGLLLIILVLVSKVPSSEVQDKIYQELMQLKTEVHDGLCQPCPRDWTFFNGSCYFFSKS--Q 124

  Fly   178 LNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNE--NTKTGDFVSAASGKSCLY 240
            .||.::...|:.:|..|..::|.:|...:.:........::|:::  |..|..:|..:.......
  Rat   125 RNWHNSITACKELGAQLVIVETDEEQTFLQQTSKTRGPTWMGLSDMHNEATWHWVDGSPLSPSFA 189

  Fly   241 HEWGPGEPHHNNDQE------------RC---VSILRKLMHVGNCT 271
            ..|..|||::..|::            ||   :..:.|.:...:||
  Rat   190 QYWNRGEPNNVGDEDCAEFSGDGWNDLRCDTRIFWICKKVSTSSCT 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 23/120 (19%)
Cd209NP_001102319.1 CLECT_DC-SIGN_like 106..228 CDD:153060 21/123 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.