DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Clec4a1

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001005890.1 Gene:Clec4a1 / 362430 RGDID:1359109 Length:243 Species:Rattus norvegicus


Alignment Length:137 Identity:31/137 - (22%)
Similarity:54/137 - (39%) Gaps:35/137 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 CLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVN 221
            |....::..|...::...| ..:|.|::.||...|.||..|.:::|.|.|.:.|:....|::|::
  Rat   111 CCPKNWKPFGSHCYFTSRD-SASWSDSEEKCSHRGAHLLVIHSQEEQDFITDTLNPRAHYYVGLS 174

  Fly   222 ENTKTGDF----------------VSAASGKS--CL---YHE----WG----PGEPHHNNDQERC 257
            :....|.:                ....||..  |:   ||.    ||    |.:.:|     |.
  Rat   175 DTEGHGKWQWVDQTPFNQNATSWHADEPSGNKGFCVVLSYHPNLKGWGWSVAPCDGYH-----RL 234

  Fly   258 VSILRKL 264
            |..:|:|
  Rat   235 VCKMRQL 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 29/125 (23%)
Clec4a1NP_001005890.1 CLECT_DC-SIGN_like 112..238 CDD:153060 28/131 (21%)

Return to query results.
Submit another query.