DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CG11211

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_610208.1 Gene:CG11211 / 35545 FlyBaseID:FBgn0033067 Length:176 Species:Drosophila melanogaster


Alignment Length:134 Identity:31/134 - (23%)
Similarity:62/134 - (46%) Gaps:18/134 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 VQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIV------EKLDDS 213
            :||         :.||.:....|:|||:|...|.|:|..||:::.:::...::      |::..:
  Fly    36 LQC---------NAYFSVAGFAEVNWLEANHVCNRVGAVLATVRNEEQHQLMLHYVNRKERIFGN 91

  Fly   214 KSYFLGVNENTKTGDFVS-AASGKSCLYHEWGPGEPHHN-NDQERCVSI-LRKLMHVGNCTYEKR 275
            ::::||.........|.: .::|....|.:|...||..: ..|:.|:.: ...|.|...|..:..
  Fly    92 RTFWLGATNLVDRSYFWTWMSTGIPVTYAQWSRREPKSDRTGQDACLVLGTDNLWHSEPCQRKHN 156

  Fly   276 FICQ 279
            |||:
  Fly   157 FICE 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 29/120 (24%)
CG11211NP_610208.1 CLECT 49..160 CDD:153057 26/110 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448846
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.