DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Lectin-galC1

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001188845.1 Gene:Lectin-galC1 / 35216 FlyBaseID:FBgn0016675 Length:186 Species:Drosophila melanogaster


Alignment Length:113 Identity:35/113 - (30%)
Similarity:52/113 - (46%) Gaps:17/113 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 FEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKS---YFLGVNEN 223
            |.||.|.|::...: .|||.:|..|||.:...|.:.:|.|||||:...|..:.|   |:...|:.
  Fly    43 FTKINDGYYFFGTE-SLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYWTSGNDL 106

  Fly   224 TKTGD---FVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVG 268
            .|||.   |.:|....|.   .|...:|.:...:|.|:       |:|
  Fly   107 AKTGSHRWFTNAQRISSL---RWARNQPDNAGQKEHCI-------HLG 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 31/106 (29%)
Lectin-galC1NP_001188845.1 CLECT 51..173 CDD:153057 30/105 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448822
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.