DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CG2839

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_608540.1 Gene:CG2839 / 33244 FlyBaseID:FBgn0031273 Length:826 Species:Drosophila melanogaster


Alignment Length:261 Identity:77/261 - (29%)
Similarity:118/261 - (45%) Gaps:61/261 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CFPTLKPVMEYVAIHQDKWNTCTEILANEAR--KDQIQ-----LNIQLDALKADVSNIKASQLSK 95
            |...:.|::|.::..|.:..|....:.||.:  .|:|:     .:.||.|||.            
  Fly    45 CLIDILPILENISEQQKEGYTANFRIFNETQGILDRIEGHQEVNDKQLKALKV------------ 97

  Fly    96 DEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQC--- 157
                 :||.....:|..:|       :|:.:..|:....|               |:|.:||   
  Fly    98 -----KMEGHFMDLHAKME-------IKVKKLSLEKSLRK---------------ALNALQCSLD 135

  Fly   158 ---------LQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDS 213
                     |.|.|||:|.|:||||..|:.||.||..|||.|||||||.:.::|...|.:|| |:
  Fly   136 TRNVSSKVSLHPEFEKVGSRFFYIERHVKQNWFDAMTKCREMGGHLASPQNEEELHLISQKL-DT 199

  Fly   214 KSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGNCTYEKRFIC 278
            :||:|.:::.|..|.::|..||....:.:|..|:|:..|.|  ||.:...|.....|.:...|||
  Fly   200 ESYWLDLSDLTDHGQYISLVSGSKAPFLKWNKGQPNRENAQ--CVRVKGGLYQTFQCDHRVLFIC 262

  Fly   279 Q 279
            |
  Fly   263 Q 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 45/111 (41%)
CG2839NP_608540.1 CLECT 147..263 CDD:214480 49/118 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448766
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D100123at33392
OrthoFinder 1 1.000 - - FOG0003272
OrthoInspector 1 1.000 - - otm72280
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.750

Return to query results.
Submit another query.