DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and RGD1564571

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_221808.5 Gene:RGD1564571 / 304197 RGDID:1564571 Length:207 Species:Rattus norvegicus


Alignment Length:193 Identity:38/193 - (19%)
Similarity:85/193 - (44%) Gaps:38/193 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IKASQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAI 152
            :|.|::...::.|:.::.   ||:           |||:.|..|:.:.....:     |..|   
  Rat    44 VKGSEVPSSQEHDQQKQR---MHQ-----------KLDQLKTGLDHLCRPCPW-----DWTF--- 86

  Fly   153 NGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSK-SY 216
                     |:  |:.||:  ...:..|.::...|:.||..|..||:.:| .:.:::....| :.
  Rat    87 ---------FQ--GNCYFF--STFQKKWKESVIACKDMGAQLVVIKSYEE-QSFLQRTSKMKGNT 137

  Fly   217 FLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGNCTYEKRFICQ 279
            ::|::::.:...::..........:.|..|||::..|:: ||.......:..:|::||.:||:
  Rat   138 WIGLSDSQEEDQWLWVDGSPLQWRNYWSAGEPNNLYDED-CVEFSSYGWNDISCSFEKFWICK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 24/112 (21%)
RGD1564571XP_221808.5 CLECT_DC-SIGN_like 80..200 CDD:153060 28/143 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.