DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Clec4m

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_038945074.1 Gene:Clec4m / 288378 RGDID:1561466 Length:336 Species:Rattus norvegicus


Alignment Length:303 Identity:64/303 - (21%)
Similarity:112/303 - (36%) Gaps:72/303 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVLNLLLVSHEFSAGTAKIEIQPLPALCNGYCFPTLKPVMEYVAIHQDKWNTCTEILANEARKDQ 71
            |||.||  |..|.||...|.:           |...|..       ..:|.       .|.::::
  Rat    63 LVLQLL--SFLFLAGLLLIIL-----------FQVFKTT-------NTQWQ-------EEPKQEK 100

  Fly    72 I--QLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAI 134
            |  :||...|.|   :|.|..|| .::|.:.....||....: :|.::|....::....:| |.|
  Rat   101 ILEELNQLTDEL---MSRIPISQ-GQNESMQEKISEQLTQLK-VELLSRIPVFQVQNESMQ-EKI 159

  Fly   135 KNTMDYMKAQMDGYFSAINGVQCLQPGFEK---------------------------IGDRYFYI 172
            ...:..:||::   .|.|..:|......::                           :|:.||..
  Rat   160 SEQLTQLKAEL---LSKIPSLQVQDESKQEKIYQQLVQMKTELLRLCRLCPWDWTFLLGNCYFLS 221

  Fly   173 EEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKS-YFLGVNE--NTKTGDFVSAAS 234
            :.  :.||.||...|:.....|..|.:.:| ...::....:|. .::|:::  |..|..:|..::
  Rat   222 KS--QRNWNDAVRACKEEKAQLVIINSDEE-QTFLQLTSKAKGPTWMGLSDLKNEATWLWVDGST 283

  Fly   235 GKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGNCTYEKRFI 277
            ..|.....|..||| :|..:|.||.......:...|..:|.:|
  Rat   284 LSSRFQKYWNRGEP-NNIGEEDCVEFAGDGWNDSKCELKKFWI 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 27/112 (24%)
Clec4mXP_038945074.1 CLECT_DC-SIGN_like 206..328 CDD:153060 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.