DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and CLEC4E

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:138 Identity:29/138 - (21%)
Similarity:56/138 - (40%) Gaps:14/138 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 IKNTMDYMKAQMDGYFSAINGV--------QCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRM 190
            |..|.|..|.|:...|:.::..        .|....:|......::...|. ::|..:...|..|
Human    48 IFQTCDEKKFQLPENFTELSCYNYGSGSVKNCCPLNWEYFQSSCYFFSTDT-ISWALSLKNCSAM 111

  Fly   191 GGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFV---SAASGKSCLYHEWGPGEPHHNN 252
            |.||..|.:::|.:.:..|....:.:|:|:::....|.:.   .....||..:  |..|||::..
Human   112 GAHLVVINSQEEQEFLSYKKPKMREFFIGLSDQVVEGQWQWVDGTPLTKSLSF--WDVGEPNNIA 174

  Fly   253 DQERCVSI 260
            ..|.|.::
Human   175 TLEDCATM 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 21/95 (22%)
CLEC4ENP_055173.1 CLECT_DC-SIGN_like 80..207 CDD:153060 22/106 (21%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 169..171 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 49 1.000 Domainoid score I11773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.