DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Sftpd

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_037010.1 Gene:Sftpd / 25350 RGDID:3667 Length:374 Species:Rattus norvegicus


Alignment Length:161 Identity:49/161 - (30%)
Similarity:78/161 - (48%) Gaps:25/161 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYI---EEDVELNWLDAQAKCRRMG 191
            |:||:...:..::|....|..|     .|.|..:.:||:.|..   ||..|    ||:..||:.|
  Rat   229 QMEALNGKLQRLEAAFSRYKKA-----ALFPDGQSVGDKIFRAANSEEPFE----DAKEMCRQAG 284

  Fly   192 GHLASIKTKQEFDAIVEKL--DDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQ 254
            |.|||.::..| :|.|::|  ..||:.||.:.:....|.| :..:|::.:|..|.||||::|...
  Rat   285 GQLASPRSATE-NAAVQQLVTAHSKAAFLSMTDVGTEGKF-TYPTGEALVYSNWAPGEPNNNGGA 347

  Fly   255 ERCVSILRKLMHVGN-----CTYEKRFICQY 280
            |.||.|...    |.     |..::..||::
  Rat   348 ENCVEIFTN----GQWNDKACGEQRLVICEF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 39/120 (33%)
SftpdNP_037010.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..221
Collagen 41..89 CDD:189968
Collagen 66..124 CDD:189968
Collagen 114..172 CDD:189968
Surfac_D-trimer 223..268 CDD:286141 11/43 (26%)
CLECT 261..374 CDD:295302 40/122 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 48 1.000 Domainoid score I11575
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5161
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.