DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Sftpa1

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001257574.1 Gene:Sftpa1 / 24773 RGDID:3665 Length:258 Species:Rattus norvegicus


Alignment Length:128 Identity:39/128 - (30%)
Similarity:58/128 - (45%) Gaps:10/128 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSY-F 217
            ||..||.....:||:.|..... .:|:...:..|.|.||::|..:|.:|.:||........:| :
  Rat   133 GVLSLQGSMLSVGDKVFSTNGQ-SVNFDTIKEMCTRAGGNIAVPRTPEENEAIASIAKKYNNYVY 196

  Fly   218 LGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGNCTYEKRFICQY 280
            ||:.|:...||| ....|.|..|..|.|||| ....:|:||.:..      :.|:..|...||
  Rat   197 LGMIEDQTPGDF-HYLDGASVNYTNWYPGEP-RGQGKEKCVEMYT------DGTWNDRGCLQY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 31/111 (28%)
Sftpa1NP_001257574.1 Collagen 37..108 CDD:460189
CLECT_collectin_like 146..258 CDD:153061 34/115 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.