DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Cd207

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:260 Identity:61/260 - (23%)
Similarity:98/260 - (37%) Gaps:65/260 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 LNIQLDA--LKADVSNIKASQLSKDEK-------------------LDRMEREQFAMHESLETIN 117
            |:::.||  ||..|.||  |.|..|.|                   |.|:..:..::..|::..|
Mouse    75 LDVKSDAQMLKGRVDNI--STLGSDLKTERGRVDDAEVQMQIVNTTLKRVRSQILSLETSMKIAN 137

  Fly   118 RYLTV------KLDRTKLQLEAIKNTMDYMKAQMDGYFSAIN-GVQCLQPGFEKI---------- 165
            ..|.:      ::|....::..:|..:|  ||      ||:| .||.||...|.:          
Mouse   138 DQLQILTMSWGEVDSLSAKIPELKRDLD--KA------SALNTKVQGLQNSLENVNKLLKQQSDI 194

  Fly   166 ------GDRY----FYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGV 220
                  |.:|    ||........|..|:..|.....||.|:.::.| ...:.|..|...:::|:
Mouse   195 LEMVARGWKYFSGNFYYFSRTPKTWYSAEQFCISRKAHLTSVSSESE-QKFLYKAADGIPHWIGL 258

  Fly   221 NENTKTGDFV---SAASGKSCLYHEWGPGEPHHNNDQERCVSI---LRKLMHVGNCTYEKRFICQ 279
            .:....||:.   ..:..|......|.||||::..:.|.|.:|   ..|..:.|.|.....|||:
Mouse   259 TKAGSEGDWYWVDQTSFNKEQSRRFWIPGEPNNAGNNEHCANIRVSALKCWNDGPCDNTFLFICK 323

  Fly   280  279
            Mouse   324  323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 30/121 (25%)
Cd207NP_659192.2 CLECT_DC-SIGN_like 201..324 CDD:153060 31/124 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5478
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.