DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Colec10

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_775598.2 Gene:Colec10 / 239447 MGIID:3606482 Length:277 Species:Mus musculus


Alignment Length:164 Identity:37/164 - (22%)
Similarity:67/164 - (40%) Gaps:25/164 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 LTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQ 184
            |.:.:.|.|..::.|||.:                     .|..:..::::||.:: |.|:.::.
Mouse   131 LDISVARLKTSMKFIKNVI---------------------AGIRETEEKFYYIVQE-EKNYRESL 173

  Fly   185 AKCRRMGGHLASIKTKQEFDAIVEKLDDSKSY--FLGVNENTKTGDFVSAASGKSCLYHEWGPGE 247
            ..||..||.||..|.:.....|.:.:..|..:  |:|||:..:.|.:|...:.....|..|...|
Mouse   174 THCRIRGGMLAMPKDEVVNTLIADYVAKSGFFRVFIGVNDLEREGQYVFTDNTPLQNYSNWKEEE 238

  Fly   248 PHHNNDQERCVSILRK-LMHVGNCTYEKRFICQY 280
            |...:..|.||.:|.. ..:...|.....|:|::
Mouse   239 PSDPSGHEDCVEMLSSGRWNDTECHLTMYFVCEF 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 30/113 (27%)
Colec10NP_775598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..103
gly_rich_SclB <46..>116 CDD:468478
CLECT_collectin_like 157..272 CDD:153061 30/115 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.