DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and FCER2

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001207429.1 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:209 Identity:50/209 - (23%)
Similarity:91/209 - (43%) Gaps:53/209 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 EILANEAR-KDQ-IQLNIQLDALKADVSNIKASQLS-KDEKLDRMEREQFAMHESLETINRYLTV 122
            |:.|.:.| |.| ::|:..|:.|:||:|:.|:.:|: ::|..|.:||                 :
Human    94 ELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLER-----------------L 141

  Fly   123 KLDRTKLQLEA------IKNTMDYMKAQMDGYFSAINGVQCLQP--GFEKIGDRYFYIEEDVELN 179
            :.:.|||::|.      :.||                   |.:.  .|::   :.:|..:..: .
Human   142 REEVTKLRMELQVSSGFVCNT-------------------CPEKWINFQR---KCYYFGKGTK-Q 183

  Fly   180 WLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWG 244
            |:.|:..|..|.|.|.||.:.:|.|.:.:....:.|: :|:......|:|: ...|....|..|.
Human   184 WVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSW-IGLRNLDLKGEFI-WVDGSHVDYSNWA 246

  Fly   245 PGEPHHNNDQERCV 258
            ||||...:..|.||
Human   247 PGEPTSRSQGEDCV 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 25/90 (28%)
FCER2NP_001207429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85
Repetitive region 69..89
RILP-like <77..153 CDD:304877 21/75 (28%)
Repetitive region 90..110 5/15 (33%)
Repetitive region 111..131 7/19 (37%)
CLECT 163..282 CDD:214480 27/104 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.