DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Mgl2

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006532975.1 Gene:Mgl2 / 216864 MGIID:2385729 Length:381 Species:Mus musculus


Alignment Length:192 Identity:42/192 - (21%)
Similarity:84/192 - (43%) Gaps:33/192 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 TLKPVMEYVAIHQDKWNTCTEILAN----EARKDQIQLNIQLDALKADVSNIKAS-QLSKD--EK 98
            ||:.:::         ||.::|.|.    ::|.|..:..|  .:||.||.:.:.. |..:|  :|
Mouse    84 TLRAILD---------NTTSKIKAEFQSLDSRADNFEKGI--SSLKVDVEDHRQELQAGRDLSQK 137

  Fly    99 LDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQ---CLQP 160
            :..:|.......::|:|....||..:.:.:..|:|:...:..:|.         ||.:   |...
Mouse   138 VTSLESTLEKREQALKTDLSDLTDHVQQLETDLKALTCQLANLKN---------NGSEVACCPLH 193

  Fly   161 GFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNE 222
            ..|..|..|::.|.  |.:|.:|...||....||..:.:.:|.:.:..:|.:..|: :|:.:
Mouse   194 WTEHEGSCYWFSES--EKSWPEADKYCRLENSHLVVVNSLEEQNFLQNRLANVLSW-MGLTD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 13/54 (24%)
Mgl2XP_006532975.1 Lectin_N 39..180 CDD:367741 23/106 (22%)
CLECT_DC-SIGN_like 190..363 CDD:153060 16/66 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5478
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.