DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Sftpd

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_033186.1 Gene:Sftpd / 20390 MGIID:109515 Length:374 Species:Mus musculus


Alignment Length:157 Identity:46/157 - (29%)
Similarity:74/157 - (47%) Gaps:17/157 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 QLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHL 194
            |:||:|..:..::.....|..|     .|.|....:||:.|. ..|.|..:.|||..|::.||.|
Mouse   229 QMEALKGKLQRLEVAFSHYQKA-----ALFPDGRSVGDKIFR-TADSEKPFEDAQEMCKQAGGQL 287

  Fly   195 ASIKTKQEFDAIVEKLD-DSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCV 258
            ||.::..|..||.:.:. .:|:.||.:.:....|.| :..:|:..:|..|.||||::|...|.||
Mouse   288 ASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKF-TYPTGEPLVYSNWAPGEPNNNGGAENCV 351

  Fly   259 SILRKLMHVGN-----CTYEKRFICQY 280
            .|...    |.     |..::..||::
Mouse   352 EIFTN----GQWNDKACGEQRLVICEF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 36/116 (31%)
SftpdNP_033186.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 38..222
gly_rich_SclB <60..>219 CDD:468478
Surfac_D-trimer 223..267 CDD:286141 11/43 (26%)
CLECT_collectin_like 261..374 CDD:153061 37/118 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.