DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Sftpa1

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_075623.2 Gene:Sftpa1 / 20387 MGIID:109518 Length:248 Species:Mus musculus


Alignment Length:130 Identity:41/130 - (31%)
Similarity:59/130 - (45%) Gaps:7/130 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSY-F 217
            ||..||.....:||:.|..... .:|:...:..|.|.|||:|:.:..:|.:||........:| :
Mouse   123 GVLSLQGSMLSVGDKVFSTNGQ-SVNFDTIREMCTRAGGHIAAPRNPEENEAIASITKKYNTYPY 186

  Fly   218 LGVNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILR--KLMHVGNCTYEKRFICQY 280
            |||.|....||| ....|.|..|..|.|||| ....:|:||.:..  |....| |...:..||::
Mouse   187 LGVIEGQTPGDF-HYLDGASVNYTNWYPGEP-RGRGKEKCVEMYTDGKWNDKG-CLQYRLAICEF 248

  Fly   281  280
            Mouse   249  248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 35/113 (31%)
Sftpa1NP_075623.2 Collagen 27..98 CDD:189968
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..100
CLECT_collectin_like 136..248 CDD:153061 36/115 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.