DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and clec-149

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_497267.2 Gene:clec-149 / 186903 WormBaseID:WBGene00019328 Length:308 Species:Caenorhabditis elegans


Alignment Length:260 Identity:56/260 - (21%)
Similarity:97/260 - (37%) Gaps:76/260 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PLPALCNGYCFPTLKPVMEYVAIHQDKWNTCTEILANEARKD----QIQLNIQLDALKADVSNIK 89
            |:|.:..| |                  |...:|.|.||:.|    :::::.|.:..|.      
 Worm   113 PIPQISQG-C------------------NCNHDIEALEAKFDKKLYEVKMHAQYETEKG------ 152

  Fly    90 ASQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAING 154
            ...|.|..:.|..|.|:....:.:|                   ||..:||::|           
 Worm   153 VGDLRKQFETDLREYERITTKDIVE-------------------IKRHLDYLQA----------- 187

  Fly   155 VQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLG 219
                 |........||:|:.  |.:|..|..||...|.|||||.::.|...:...:..:::.::|
 Worm   188 -----PRITNNDLEYFFIQR--EESWYTASEKCIGYGAHLASIHSRLELGFVQRLVPVNQTAWIG 245

  Fly   220 VNENTKTGDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGN-----CTYEKRFICQ 279
            ||:..|...|.: :.|....:::||..:|.:....|.||.:    .|.|.     |...:.|:|:
 Worm   246 VNDIQKENVFRN-SDGTPVDFYKWGKKQPDNQEHNENCVEV----DHSGQWTDKLCIITRPFVCK 305

  Fly   280  279
             Worm   306  305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 32/116 (28%)
clec-149NP_497267.2 CLECT 197..306 CDD:153057 32/116 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I4072
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.060

Return to query results.
Submit another query.