DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and clec-199

DIOPT Version :10

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001255942.1 Gene:clec-199 / 183064 WormBaseID:WBGene00007820 Length:667 Species:Caenorhabditis elegans


Alignment Length:126 Identity:27/126 - (21%)
Similarity:54/126 - (42%) Gaps:28/126 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LNWLDAQAKC--RRMGGHLASIKTKQEFDAI-------VEKLDDSKSYFLGVNENTKTGDFVSAA 233
            |:|..::..|  ::.|.||||:.::.|.:.:       ..|:||    ::|:..|.....: :..
 Worm   121 LSWYASEDWCYSQKAGAHLASVHSRAEAEWLNYQYKLWWSKMDD----WIGLRRNCDNTAW-AWT 180

  Fly   234 SGKSCLYHEWGPGEPHHNNDQERCV-----SILRKL-------MHVG-NCTYEKRF-ICQY 280
            .|....:..|.|..|.:...::.|.     ::||.:       |..| :||....: :|:|
 Worm   181 DGTPVDFLWWQPNYPIYGGIEDSCTAMWDSTVLRGMYDFYPGQMDDGRSCTGSVAWALCKY 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 26/124 (21%)
clec-199NP_001255942.1 CLECT 99..210 CDD:214480 19/93 (20%)
CLECT 549..664 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.