DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and clec-178

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_500843.1 Gene:clec-178 / 177344 WormBaseID:WBGene00020585 Length:178 Species:Caenorhabditis elegans


Alignment Length:140 Identity:37/140 - (26%)
Similarity:63/140 - (45%) Gaps:16/140 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 YLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAIN---GVQCL------QPGFEKIGDRYFYIEE 174
            ||.:....|.:....:|::...:..|     .|||   .|:.|      |.|::...|.::.:.|
 Worm     7 YLLIPTINTVVIPSPLKSSYQSIAGQ-----RAINLDVNVRLLTVLALQQSGWQLYEDHWYKMFE 66

  Fly   175 DVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCL 239
             .::.|:.|:..||.|||||.|||.:.| :..|.||....:.::|:|:...|......:.|....
 Worm    67 -TDVMWIPAENVCRSMGGHLVSIKDESE-NLFVHKLRKKNNIWIGLNKLNDTFHVYKWSDGSEAD 129

  Fly   240 YHEWGPGEPH 249
            |..|...:|:
 Worm   130 YLNWASSQPN 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 24/81 (30%)
clec-178NP_500843.1 CLECT 52..174 CDD:214480 26/90 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 63 1.000 Domainoid score I6773
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X29
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.