DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Mbl2

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001351987.1 Gene:Mbl2 / 17195 MGIID:96924 Length:244 Species:Mus musculus


Alignment Length:191 Identity:46/191 - (24%)
Similarity:76/191 - (39%) Gaps:46/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 KLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGF 162
            |.||.:|.:|...|        :..::...:.:|.|::|.:.:..:                   
Mouse    90 KGDRGDRAEFDTSE--------IDSEIAALRSELRALRNWVLFSLS------------------- 127

  Fly   163 EKIGDRYFYIEEDVELNWLD-AQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKT 226
            ||:|.:||.  ..|:...|| .:|.|....|.:|:.:..:|..||.:...|..  :||:.:....
Mouse   128 EKVGKKYFV--SSVKKMSLDRVKALCSEFQGSVATPRNAEENSAIQKVAKDIA--YLGITDVRVE 188

  Fly   227 GDFVSAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGN-------CTYEKRFICQY 280
            |.| ...:|....|..|..|||::..|.|.||.||      ||       |:.....||::
Mouse   189 GSF-EDLTGNRVRYTNWNDGEPNNTGDGEDCVVIL------GNGKWNDVPCSDSFLAICEF 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 34/118 (29%)
Mbl2NP_001351987.1 Collagen 36..93 CDD:189968 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..101 5/10 (50%)
CLECT 132..242 CDD:382969 34/120 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.