DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Cd209e

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_570975.1 Gene:Cd209e / 170780 MGIID:2157948 Length:208 Species:Mus musculus


Alignment Length:197 Identity:40/197 - (20%)
Similarity:80/197 - (40%) Gaps:41/197 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IKASQLSKDEKLDRMEREQFAMHESLETINRYLTVKLDRTKLQLEAIKNTMDYMKAQMDGYFSAI 152
            |:.|::...|::.....:|..|::                  .|..:|:.:|.:.......::..
Mouse    38 IQVSKMPSSEEIQWEHTKQEKMYK------------------DLSQLKSEVDRLCRLCPWDWTFF 84

  Fly   153 NGVQCLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLASIKTKQEFDAIVEKLDDSKSY- 216
            || .|           ||:.:.  :.:|.|:...|:.||..|..||:.:| .:.:::.....|| 
Mouse    85 NG-NC-----------YFFSKS--QRDWHDSMTACKEMGAQLVIIKSHEE-QSFLQQTSKKNSYT 134

  Fly   217 FLGVNENTKTGDFV----SAASGKSCLYHEWGPGEPHHNNDQERCVSILRKLMHVGNCTYEKRFI 277
            ::|:::..|.|::.    |..|.....|  |..|:|::...|: ||.......:...|...|.:|
Mouse   135 WMGLSDLNKEGEWYWLDGSPLSDSFEKY--WKKGQPNNVGGQD-CVEFRDNGWNDAKCEQRKFWI 196

  Fly   278 CQ 279
            |:
Mouse   197 CK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 29/116 (25%)
Cd209eNP_570975.1 CLECT_DC-SIGN_like 77..199 CDD:153060 32/140 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100086
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.