DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Fcer2a

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:XP_006508760.1 Gene:Fcer2a / 14128 MGIID:95497 Length:335 Species:Mus musculus


Alignment Length:224 Identity:50/224 - (22%)
Similarity:90/224 - (40%) Gaps:54/224 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ARKDQ-IQLNIQLDALKADVSNIKASQLSKDEKLDRMEREQFAMHESL---ETINRYLTVKLDRT 127
            |:|.| :|::..|..|:|:...:||..       .|:.:....:.|.|   ::.|..|:..|:|.
Mouse    86 AQKSQVVQMSQNLQELQAEQKQMKAQD-------SRLSQNLTGLQEDLRNAQSQNSKLSQNLNRL 143

  Fly   128 KLQLEAIKNTMDYMKAQMDGYFSAINGVQCLQPGFEKIGDRYFYIEEDVEL-----------NWL 181
            :..|..||:.             .:|..:......||:.:....:..::.:           |||
Mouse   144 QDDLVNIKSL-------------GLNEKRTASDSLEKLQEEVAKLWIEILISKGTACNICPKNWL 195

  Fly   182 DAQAKCRRMG-----------------GHLASIKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDF 229
            ..|.||...|                 |.|.||.:::|.|.:::.: :.|..::|:.:....|:|
Mouse   196 HFQQKCYYFGKGSKQWIQARFACSDLQGRLVSIHSQKEQDFLMQHI-NKKDSWIGLQDLNMEGEF 259

  Fly   230 VSAASGKSCLYHEWGPGEPHHNNDQERCV 258
            | .:.|....|..|.||||::....|.||
Mouse   260 V-WSDGSPVGYSNWNPGEPNNGGQGEDCV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 28/118 (24%)
Fcer2aXP_006508760.1 SH3_and_anchor <77..>175 CDD:275056 22/108 (20%)
CLECT_DC-SIGN_like 190..310 CDD:153060 28/100 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22802
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.