DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment lectin-24A and Asgr1

DIOPT Version :9

Sequence 1:NP_652637.1 Gene:lectin-24A / 53543 FlyBaseID:FBgn0040104 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001278060.1 Gene:Asgr1 / 11889 MGIID:88081 Length:284 Species:Mus musculus


Alignment Length:223 Identity:39/223 - (17%)
Similarity:81/223 - (36%) Gaps:25/223 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 QLNIQLDALKADVSNIKASQLSKDEKL----DRMEREQFAMHESLETINRYLTVKLDRTKLQLEA 133
            ||...|.||:.:.||:..|...:.:.|    ..:.|:...:...||...:.||.......|.::.
Mouse    64 QLREDLLALRQNFSNLTVSTEDQVKALSTQGSSVGRKMKLVESKLEKQQKDLTEDHSSLLLHVKQ 128

  Fly   134 IKNTMDYMKAQMDGYFSAINGVQ--CLQPGFEKIGDRYFYIEEDVELNWLDAQAKCRRMGGHLAS 196
            :.:.:..:..||..:..  ||.:  |....:.:.....::....|. .|.:|...|:....||..
Mouse   129 LVSDVRSLSCQMAAFRG--NGSERTCCPINWVEYEGSCYWFSSSVR-PWTEADKYCQLENAHLVV 190

  Fly   197 IKTKQEFDAIVEKLDDSKSYFLGVNENTKTGDFVSAASGKSCLYHEWGPGEP-----HHNNDQER 256
            :.::.|.:.:...:....:: :|:.:......:|.....::. :..|.|.:|     |.....|.
Mouse   191 VTSRDEQNFLQRHMGPLNTW-IGLTDQNGPWKWVDGTDYETG-FQNWRPEQPDNWYGHGLGGGED 253

  Fly   257 CVSILRKLMHVGN-----CTYEKRFICQ 279
            |......    |.     |....|::|:
Mouse   254 CAHFTTD----GRWNDDVCRRPYRWVCE 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
lectin-24ANP_652637.1 CLECT 169..280 CDD:153057 19/121 (16%)
Asgr1NP_001278060.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25
Endocytosis signal. /evidence=ECO:0000255 5..8
Lectin_N 15..143 CDD:397859 17/78 (22%)
CLECT_DC-SIGN_like 153..278 CDD:153060 19/132 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I5478
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.